PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00115.130
Common NameGRAS40, GRAS42, JCGZ_19009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GRAS
Protein Properties Length: 568aa    MW: 64145.7 Da    PI: 4.9
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00115.130genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.86.9e-921955651373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalkl..fsevsPilk 92 
                     lve Ll+ Ae v +++ e+a++lL+     +s++g+p+qR++ yf eAL++r+     +++++  + s++ + n++ ++ +      ++  P+++
  Jcr4S00115.130 195 LVEFLLASAEKVGNQQYERATRLLNYCDISSSNTGNPVQRVVYYFSEALRERIDVGAGRISSKGfKKSQSFNLNQQMTILSSASfaCHQRIPFFQ 289
                     57889************************************************9855555554425555444443333333333257899***** PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                     ++ +ta qaI+e ++ge+r+H+iD++i +G+QW  L+qaL+sR + p   l+i ++g    +sk+ +  tg+ La+fAe++++pf+f++++ +++
  Jcr4S00115.130 290 VASFTAIQAIVENMAGEKRIHVIDLEIRKGVQWSVLMQALSSRHDCPIeLLKISAIGT---TSKQLIDDTGKTLASFAESMNIPFSFKAVMISDM 381
                     ********************************************6554499*******...689******************************* PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      dl+ + L+++++Ea+a+ + ++l ++       +++ d+v+++++++sP+++vv+e ea+ ns+sF++rf+eal +ysa fd+++a + r++ +
  Jcr4S00115.130 382 LDLKEDLLELDTEEAIAIYSEYSLNNFI----FAPNRLDSVMRVLRNISPQIMVVMEVEANNNSPSFVNRFIEALFFYSAYFDCFDACMDRDDPN 472
                     ***************************9....45555677******************************************************* PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                     r+  E  ++++ i+n+va+eg+err rh +  +Wr+ + ++G  ++++s++ + qa l+l+k++ +   +++ +++sl++gWk+ p+ s+S+W
  Jcr4S00115.130 473 RMITEMIFFHQGIRNIVANEGEERRVRHVKIDTWRSFFARFGIIEAQISTSSMYQATLMLKKFDcGSSCTLDMNNKSLLIGWKGTPIHSLSVW 565
                     ****************************************************************9999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.17169545IPR005202Transcription factor GRAS
PfamPF035142.4E-89195565IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MADAMLSFDY DFGTARDGLT SSSKSSGGID YGLYQMDSSL DEGFLFSKYQ QQEQVLQPSF  60
GYKDFDDQRL DVLSPLLQTY LEEIANPDEI PRGIKDDSEP KKTSQHYFSL ASLELLKKYG  120
NNGRLNGGRI IDPSSDALYT KHARSELSTE EIIRIAGARF IQSCCQTTDV ASMLNNPFSL  180
SFSDLSSEVA KNVELVEFLL ASAEKVGNQQ YERATRLLNY CDISSSNTGN PVQRVVYYFS  240
EALRERIDVG AGRISSKGFK KSQSFNLNQQ MTILSSASFA CHQRIPFFQV ASFTAIQAIV  300
ENMAGEKRIH VIDLEIRKGV QWSVLMQALS SRHDCPIELL KISAIGTTSK QLIDDTGKTL  360
ASFAESMNIP FSFKAVMISD MLDLKEDLLE LDTEEAIAIY SEYSLNNFIF APNRLDSVMR  420
VLRNISPQIM VVMEVEANNN SPSFVNRFIE ALFFYSAYFD CFDACMDRDD PNRMITEMIF  480
FHQGIRNIVA NEGEERRVRH VKIDTWRSFF ARFGIIEAQI STSSMYQATL MLKKFDCGSS  540
CTLDMNNKSL LIGWKGTPIH SLSVWNFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3722456632375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4052890.0KM405289.1 Jatropha curcas GRAS40 protein (GRAS40) mRNA, complete cds.
GenBankKM4052930.0KM405293.1 Jatropha curcas GRAS42 protein (GRAS42) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084259.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067K7Y30.0A0A067K7Y3_JATCU; GRAS40 protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-52GRAS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]